2r is the irregular law firm dealing with cases against organized crime, religious crimes, large-scale fraud, corruption. Founded in 2001 by Raevskaya-Repnina. www.irregulaw.com #2R #lawfirm #irregulaw #beinghuman #raevskayarepnina #organisedcrime #corruption #naturallaw #humanrights #criminaljustice #criminology #humanrights #equality #diversity #startedinoxford #oxfordsbs #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #global #moscow #uk #oxford #portsmouth #london #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #raevskayarepnina #annamariaserafimaraevskayarepnina #raevskayarepninaannamariaserafima

#IRREGULAW

2r is the irregular law firm dealing with cases against organized crime, serial crimes, religious crimes, large-scale fraud, corruption.

ORDER ONLINE

Irregular Law

2r works with law anomalies - when regular law does not work as it should be due to organized crime, corruption, politics, or something else. 2r focuses on irregular, enormous projects, combining law, finance, business, economics, religious, political issues. Irregularity implies that 2r works on an irregular basis. We arrange for the team to address the specific needs of an individual project.

2r offers the complete set of services for non-standard situations.

Our Services

2R works with the businesses or shareholders facing a hostile takeover, any forms of illegal prosecution, an unlawful conviction of a felony, unlawful tax claims.
2R helps when the case combines economics, business, political, religious, security, tax evasion, corruption issues if you are a victim.
2R mitigates corporate conflicts and protects your company from illegal capture.
2R investigates corporate fraud as well as difficult sensitive or confidential issues.

Our Irregularity

Multi-dimensional Approach

2R analyzes every case and develops a strategy of the litigation based on a 360-degree methodology. 2R considers all aspects of the case beyond the legal issues.

Standardization of Response

During the years of practice, 2R has developed the standard approach for every irregulaw case. We apply that for every non-standard situation, which is routine for us. Our strategy is based on the predefined set of actions that we perform in the predefined sequence.

Civil Claim in Criminal Process

If the loss has been caused by the criminal offense, the real loss indemnification will be possible just as a civil claim in the criminal process. You never win if the civil process starts first. Our strategy is to reach the starting of a criminal proceeding, collect evidence, and avoid the civil claims as long as possible, even though it can be very hard.